DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and Gstz1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_034493.1 Gene:Gstz1 / 14874 MGIID:1341859 Length:216 Species:Mus musculus


Alignment Length:188 Identity:59/188 - (31%)
Similarity:95/188 - (50%) Gaps:13/188 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VKLTLAALNLTYEYVNVDIV--ARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYA 80
            |::.||...:.||.|.::::  ...|.:.|:...||...||.|:.||..|..|.||:.|| .:..
Mouse    20 VRIALALKGIDYEIVPINLIKDGGQQFTEEFQTLNPMKQVPALKIDGITIVQSLAIMEYL-EETR 83

  Fly    81 DSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISK-SVLFQ-GQTKVPKERYDAIIEIYDFVE 143
            ....|.|:||.|||:|  |:..:   :.|:||:.:.. |||.| ||....:.....|...::.:|
Mouse    84 PIPRLLPQDPQKRAIV--RMISD---LIASGIQPLQNLSVLKQVGQENQMQWAQKVITSGFNALE 143

  Fly   144 TFLKGQ--DYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQLPYYE 199
            ..|:..  .|..|:::::||..||..||:.|.| .:|.:.||.|....|:|..|..::
Mouse   144 KILQSTAGKYCVGDEVSMADVCLVPQVANAERF-KVDLSPYPTISHINKELLALEVFQ 200

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 58/183 (32%)
GST_N_Delta_Epsilon 4..77 CDD:239343 21/60 (35%)
GST_C_Delta_Epsilon 91..209 CDD:198287 34/113 (30%)
Gstz1NP_034493.1 GST_N_Zeta 6..80 CDD:239340 21/60 (35%)
maiA 7..211 CDD:273527 59/188 (31%)
Glutathione binding 14..19