DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and C02D5.4

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001254962.1 Gene:C02D5.4 / 13190517 WormBaseID:WBGene00043097 Length:254 Species:Caenorhabditis elegans


Alignment Length:230 Identity:60/230 - (26%)
Similarity:95/230 - (41%) Gaps:46/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPE-YLEKNPQHTVPTLE-DDG-HYI 65
            :.:|.:...|..:...:..:..|:..:.:||.:    |..|: |..|:.:..||||| |:| .::
 Worm    27 IRIYNMRFCPWAQRALIYASVKNIPSDVINVHL----QEKPDWYFSKHYKGQVPTLEHDEGKKHV 87

  Fly    66 WDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFE--SGVVFANGIRSISKSVLFQGQTKVP 128
            .:|..|..||...|.::..| |.||.::  |.|:|..:  ||.|          |..|.|..:..
 Worm    88 IESAVIPEYLDDIYPETRIL-PTDPYEK--VQQKLLLDRISGQV----------SPAFYGVVQAV 139

  Fly   129 K------ERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVA------------SLEAFV 175
            |      |::..|.:.||..|..|.|..|...::....|:.|..::.            .||| .
 Worm   140 KNPDLREEKFADIKKAYDNAEQLLTGDFYSGTSKPGFVDYLLYPNIQRAYWAAHIVPDFPLEA-E 203

  Fly   176 ALDTTKYPRIGAWIKKLEQLPYYEEA-----NGKG 205
            :.....|||:..|.|.||.:|....|     ||.|
 Worm   204 SFPGPNYPRLSKWYKALESIPEVAAASQPTENGVG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 55/214 (26%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/75 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 35/140 (25%)
C02D5.4NP_001254962.1 Thioredoxin_like 8..98 CDD:294274 19/74 (26%)
GstA 29..229 CDD:223698 56/217 (26%)
GST_C_family 112..243 CDD:295467 35/140 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.