DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and GSTO2

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:219 Identity:44/219 - (20%)
Similarity:81/219 - (36%) Gaps:57/219 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPE-YLEKNPQHTVPTLE-DDGHYIW 66
            :.:|.:...|.....:|.|.|.::.:|.||:::    :..|| |..|:|...:|.|| .....|:
Human    24 IRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINL----RNKPEWYYTKHPFGHIPVLETSQCQLIY 84

  Fly    67 DSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVP--- 128
            :|.....||...| ....|:|.||.:||                     .:.:|.:...|||   
Human    85 ESVIACEYLDDAY-PGRKLFPYDPYERA---------------------RQKMLLELFCKVPHLT 127

  Fly   129 --------------------KERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEA 173
                                ::.:..:.||.::..|     .:..|..:::.|:.|......|:.
Human   128 KECLVALRCGRECTNLKAALRQEFSNLEEILEYQNT-----TFFGGTCISMIDYLLWPWFERLDV 187

  Fly   174 FVALDTTKY-PRIGAWIKKLEQLP 196
            :..||...: |.:..||..::..|
Human   188 YGILDCVSHTPALRLWISAMKWDP 211

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 43/217 (20%)
GST_N_Delta_Epsilon 4..77 CDD:239343 20/74 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 19/130 (15%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 19/73 (26%)