DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and Gsto1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001007603.1 Gene:Gsto1 / 114846 RGDID:70952 Length:241 Species:Rattus norvegicus


Alignment Length:218 Identity:53/218 - (24%)
Similarity:95/218 - (43%) Gaps:54/218 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPE-YLEKNPQHTVPTLED-DGHYI 65
            ::.:|.:...|..:...:.|.|..:.:|.:|:::    :..|| :.||||...||.||: .||.|
  Rat    23 QIRVYSMRFCPFAQRTLMVLKAKGIRHEIININL----KNKPEWFFEKNPFGLVPVLENTQGHLI 83

  Fly    66 WDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVP-- 128
            .:|.....||...|.:. .|:|.||.::|.  |::.||                ||   :|||  
  Rat    84 TESVITCEYLDEAYPEK-KLFPDDPYEKAC--QKMTFE----------------LF---SKVPSL 126

  Fly   129 ---------KERYDAIIEIYDFVETFLKGQD--------YIAGNQLTIADFSL---VSSVASLEA 173
                     ||.:..|.|  :..:.|.|.::        :..||.|::.|:.:   ...:.:||.
  Rat   127 VTSFIRAKRKEDHPGIKE--ELKKEFSKLEEAMAKKRTAFFGGNSLSMIDYLIWPWFQRLEALEL 189

  Fly   174 FVALDTTKYPRIGAWIKKLEQLP 196
            ...:|.|  |::..|:..:::.|
  Rat   190 NECIDHT--PKLKLWMATMQEDP 210

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 52/215 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 22/74 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/128 (20%)
Gsto1NP_001007603.1 GST_N_Omega 5..94 CDD:239353 21/74 (28%)
GstA 26..214 CDD:223698 53/215 (25%)