DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and vars1

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001298275.1 Gene:vars1 / 114427 ZFINID:ZDB-GENE-010601-1 Length:1271 Species:Danio rerio


Alignment Length:217 Identity:45/217 - (20%)
Similarity:74/217 - (34%) Gaps:67/217 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKNPQHTVPTLE-----DDGHY 64
            |||        ..:::.|..|:....:|:.::..|..      .:.|:.:.|::.     |...:
Zfish  1054 TLY--------TCLEVGLRLLSPIMPFVSEELFQRLP------RRRPRDSPPSISVTPYPDTAEF 1104

  Fly    65 IWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPK 129
            .|.|..                         ||:::.|...||  ..|||:      :....:.|
Zfish  1105 CWHSED-------------------------VDRQMEFVMSVV--RTIRSL------RADYNLTK 1136

  Fly   130 ERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEAF-----VALDTTKYPRIGAWI 189
            .|.|..::..| .||....|.|....| |::....|.||....|.     ||:.:.|. .:...:
Zfish  1137 TRADCFLQCID-SETAALVQKYSLQIQ-TLSYSQAVHSVVGDAAIPQGCAVAIASDKC-TVNLML 1198

  Fly   190 KKLEQLPYYEEANGKGVRQLVA 211
            |.|..|       ||.|.:|.|
Zfish  1199 KGLIDL-------GKEVTKLTA 1213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 39/200 (20%)
GST_N_Delta_Epsilon 4..77 CDD:239343 12/76 (16%)
GST_C_Delta_Epsilon 91..209 CDD:198287 31/122 (25%)
vars1NP_001298275.1 GstA <45..192 CDD:223698
GST_C_ValRS_N 80..202 CDD:198327
PTZ00419 291..1270 CDD:240411 45/217 (21%)
ValRS_core 340..941 CDD:185677
tRNA-synt_1_2 518..643 CDD:290334
Anticodon_Ia_Val 941..1081 CDD:153416 6/34 (18%)
Val_tRNA-synt_C 1203..1266 CDD:287436 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.