DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and LOC100911464

DIOPT Version :10

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_038967329.1 Gene:LOC100911464 / 100911464 RGDID:6492721 Length:249 Species:Rattus norvegicus


Alignment Length:163 Identity:36/163 - (22%)
Similarity:64/163 - (39%) Gaps:49/163 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 HT-----VPTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPLKRAVVD------QRLHFE--- 103
            ||     :|..||....::.|.||:.::    ..|..||.|...:.|:||      :.||:.   
  Rat    95 HTCLYGQLPKFEDGDLTLYQSSAILRHV----GHSFGLYGKGQREAALVDMVNDGVEDLHYRYVT 155

  Fly   104 -SGVVFANGIRSISKSVLFQGQTKVPKERYDAIIEIYDFVETFL----KGQDYIAGNQLTIADFS 163
             ...::.||.....|::  .|..|.              .||.|    :|:.:|.|:|::.|:::
  Rat   156 LIYTIYENGKDDYMKAL--PGHLKP--------------FETLLSQNQEGKAFIVGDQISFANYN 204

  Fly   164 LVSSVASLEAFVALDTTKYPRIGAWIKKLEQLP 196
            |:.          |....:|.:.|::..|...|
  Rat   205 LLD----------LLLVHFPLLAAYVVHLSAQP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..201 CDD:440390 36/163 (22%)
LOC100911464XP_038967329.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold <96..123 CDD:469754 7/30 (23%)
GST_C_family 133..249 CDD:470672 24/121 (20%)

Return to query results.
Submit another query.