DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and clic6

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_002941923.2 Gene:clic6 / 100486547 XenbaseID:XB-GENE-6039572 Length:831 Species:Xenopus tropicalis


Alignment Length:184 Identity:37/184 - (20%)
Similarity:66/184 - (35%) Gaps:62/184 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRLHFESGVVF 108
            |.|.:..|:|  |.....|:.::          :|:    :.|.|:|.|    |.....|.|  |
 Frog   681 PRYPKLAPKH--PESSSAGNDVF----------AKF----SAYIKNPRK----DLNAALEKG--F 723

  Fly   109 ANGIRSISKSVLFQGQTKVPKERYDAIIEIYDFVETFLKGQDYIAGNQLTIADFSLVSSVASLEA 173
            ...:|.:...:    .|.:|.|     |:.|...:..:..:.::.||:||:||.:|:..:..::.
 Frog   724 LRSLRKLDDFL----NTPLPDE-----IDAYSTEDITISDRKFLDGNELTLADCNLLPKLQIIKV 779

  Fly   174 F--------VALDTTKYPRIGAWIKKLEQLPYYEEANGKGVRQLVAIFKKTNFT 219
            .        :..|.|     |.|                  |.|.:.|.:..||
 Frog   780 VAKKYRNFEIPTDMT-----GIW------------------RYLNSAFARDEFT 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 32/159 (20%)
GST_N_Delta_Epsilon 4..77 CDD:239343 6/32 (19%)
GST_C_Delta_Epsilon 91..209 CDD:198287 23/125 (18%)
clic6XP_002941923.2 PHA03418 <8..131 CDD:177646
GST_N_CLIC 595..683 CDD:239359 1/1 (100%)
O-ClC 598..831 CDD:129941 37/184 (20%)
GST_C_CLIC6 690..829 CDD:198334 34/175 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.