DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE6 and LOC100333907

DIOPT Version :9

Sequence 1:NP_611328.1 Gene:GstE6 / 37111 FlyBaseID:FBgn0063494 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_009303556.1 Gene:LOC100333907 / 100333907 -ID:- Length:249 Species:Danio rerio


Alignment Length:156 Identity:31/156 - (19%)
Similarity:58/156 - (37%) Gaps:39/156 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NVDIVARAQLSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPLKRAVVD 97
            ||..|...:...:..:..|....|.:..:|..:.|.:.|..:|..:.....  |||...|     
Zfish    50 NVTTVDLKRKPADLQDLAPGTNPPFMTFNGEVLVDVNKIEEFLEERLGPPQ--YPKLATK----- 107

  Fly    98 QRLHFESGVVFANGIRSISKSVLFQGQTKVPKERYDAIIE---------IYDFVETFL------- 146
               |.||...   ||...:|   |....|.|::..:..:|         :.::::|.|       
Zfish   108 ---HPESNTA---GIDVFAK---FSAYIKNPRKEANEGLEKALLKSLKRLDEYLQTPLPEEIDAD 163

  Fly   147 -------KGQDYIAGNQLTIADFSLV 165
                   ..:.::.|::||:||.:|:
Zfish   164 SLEDPGASTRSFLDGDELTLADCNLL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE6NP_611328.1 GstA 4..196 CDD:223698 31/156 (20%)
GST_N_Delta_Epsilon 4..77 CDD:239343 9/43 (21%)
GST_C_Delta_Epsilon 91..209 CDD:198287 19/98 (19%)
LOC100333907XP_009303556.1 O-ClC 14..249 CDD:129941 31/156 (20%)
GST_N_CLIC 14..101 CDD:239359 9/52 (17%)
GST_C_family 108..248 CDD:295467 18/88 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.