DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and sspA

DIOPT Version :10

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_417696.1 Gene:sspA / 944744 ECOCYCID:EG10977 Length:212 Species:Escherichia coli


Alignment Length:215 Identity:44/215 - (20%)
Similarity:78/215 - (36%) Gaps:77/215 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDSHAIIAYLVSKYADS 82
            |::.||...:.:|..:|.   ::...::.:..||..:||||.|....:|:|..|:.||..::...
E. coli    25 VRIVLAEKGVSFEIEHVE---KDNPPQDLIDLNPNQSVPTLVDRELTLWESRIIMEYLDERFPHP 86

  Fly    83 DAL--YPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERYDAIVEIYDFVETF 145
            ..:  ||   :.|.  :.||:                      ::||.|       :.|..:.|.
E. coli    87 PLMPVYP---VARG--ESRLY----------------------MHRIEK-------DWYTLMNTI 117

  Fly   146 L--------AGHDYIAGDQLTIA------------DFSLISSITSLVAFVEIDRLKYPRIIEWVR 190
            :        |....:..:.|.||            :|||:..              |...:.|  
E. coli   118 INGSASEADAARKQLREELLAIAPVFGQKPYFLSDEFSLVDC--------------YLAPLLW-- 166

  Fly   191 RLEKLPYYEEANAKGARELE 210
            ||.:|..  |.:..||:||:
E. coli   167 RLPQLGI--EFSGPGAKELK 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..210 CDD:440390 43/213 (20%)
sspANP_417696.1 sspA 1..211 CDD:236537 44/215 (20%)

Return to query results.
Submit another query.