DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GSTO1

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_004823.1 Gene:GSTO1 / 9446 HGNCID:13312 Length:241 Species:Homo sapiens


Alignment Length:197 Identity:50/197 - (25%)
Similarity:76/197 - (38%) Gaps:30/197 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLED-DGNYIWD 67
            :.:|.:...|.....:|.|.|..:.:|.:|:|:..:   .|.:.||||...||.||: .|..|::
Human    24 IRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNK---PEWFFKKNPFGLVPVLENSQGQLIYE 85

  Fly    68 SHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERY 132
            |.....||...| ....|.|.|..::|.....|...:.|....|       .|....|   ||.|
Human    86 SAITCEYLDEAY-PGKKLLPDDPYEKACQKMILELFSKVPSLVG-------SFIRSQN---KEDY 139

  Fly   133 DAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVRRLEKLPY 197
            ..:.|  :|.:.|....:.:...:.|....:.||.         ||.|.:|    |..|||.:..
Human   140 AGLKE--EFRKEFTKLEEVLTNKKTTFFGGNSISM---------IDYLIWP----WFERLEAMKL 189

  Fly   198 YE 199
            .|
Human   190 NE 191

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 49/192 (26%)
Thioredoxin_like 4..77 CDD:294274 22/73 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 24/109 (22%)
GSTO1NP_004823.1 GST_N_Omega 5..94 CDD:239353 21/72 (29%)