DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Clic5

DIOPT Version :10

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_446055.1 Gene:Clic5 / 94272 RGDID:620659 Length:251 Species:Rattus norvegicus


Alignment Length:160 Identity:35/160 - (21%)
Similarity:62/160 - (38%) Gaps:49/160 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LKKNPE--HTV------PTLEDDGNYIWDSHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFE 103
            ||:.|.  |.:      |.|..:|:...|.:.|..:|........  ||: |..|       |.|
  Rat    56 LKRKPADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEK--YPK-LAAR-------HRE 110

  Fly   104 TGVVFANGIKAITKPLFFNGLNRIPKERYDAIVE---------IYDFVETFL------------- 146
            :...   ||...:|   |:...:..|::.:|.:|         :.|::.|.|             
  Rat   111 SNTA---GIDIFSK---FSAYIKNTKQQNNAALERGLTKALRKLDDYLNTPLPEEIDTNTHGDEK 169

  Fly   147 -AGHDYIAGDQLTIADFSLISS--ITSLVA 173
             :...::.||:||:||.:|:..  :..:||
  Rat   170 GSQRKFLDGDELTLADCNLLPKLHVVKIVA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..210 CDD:440390 35/160 (22%)
Clic5NP_446055.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..98 10/41 (24%)
O-ClC 14..249 CDD:129941 35/160 (22%)
G-site. /evidence=ECO:0000250|UniProtKB:O00299 32..35
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.