DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and CLIC3

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_004660.2 Gene:CLIC3 / 9022 HGNCID:2064 Length:236 Species:Homo sapiens


Alignment Length:240 Identity:47/240 - (19%)
Similarity:87/240 - (36%) Gaps:49/240 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLY--------GVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLE 59
            ||.|:        .|...|..:.:.:.|....:|:....|:......:.:::.   |...:|.|.
Human     5 KLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFA---PGSQLPILL 66

  Fly    60 DDGNYIWDSHAIIAYLVSKYADSD--ALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFN 122
            .|.:...|:..|..:|.......|  :|.||........:...| :......|.:.|..:.|:..
Human    67 YDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFH-KFSAFIKNPVPAQDEALYQQ 130

  Fly   123 GLNRIPKERYDAIVEIYDFVETFLAGHD--------YIAGDQLTIADFSLISSITSLVAFVEIDR 179
            .|..:  .|.|:.:...  :|..|||..        ::.||:||:||.||:..:           
Human   131 LLRAL--ARLDSYLRAP--LEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKL----------- 180

  Fly   180 LKYPRIIEWV---RRLEKLPYYEEANAKGARE-LETILKSTNFTF 220
                .|::.|   .|...:|    |..:|.|. |::.::...|.:
Human   181 ----HIVDTVCAHFRQAPIP----AELRGVRRYLDSAMQEKEFKY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 40/212 (19%)
Thioredoxin_like 4..77 CDD:294274 14/80 (18%)
GST_C_Delta_Epsilon 91..209 CDD:198287 26/129 (20%)
CLIC3NP_004660.2 Required for insertion into the membrane. /evidence=ECO:0000250 1..88 15/85 (18%)
PLN02817 5..229 CDD:330276 47/240 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154455
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.