DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and CAM1

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:45/204 - (22%)
Similarity:83/204 - (40%) Gaps:31/204 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNY-IWDSHAIIAY 74
            |...|:|:||            :|.:...:..:|::.:..|...||.......| :.::.||..|
Yeast    17 PRGLVKALKL------------DVKVVTPDAAAEQFARDFPLKKVPAFVGPKGYKLTEAMAINYY 69

  Fly    75 LVSKYADSDALYPR------DLLQRAVV---DQRLHFETGVVFANGIKAITKPLFFNGLNRIPKE 130
            || |.:..|.:..:      ||..:|.:   ....:.:..:..||.|..:.....:|  .:....
Yeast    70 LV-KLSQDDKMKTQLLGADDDLNAQAQIIRWQSLANSDLCIQIANTIVPLKGGAPYN--KKSVDS 131

  Fly   131 RYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSIT----SLVAFVEIDRLKYPRIIEWVRR 191
            ..||:.:|.|..|..|..:.|:|.:.:::||....|..|    ||  |....|.::|.|:.|...
Yeast   132 AMDAVDKIVDIFENRLKNYTYLATENISLADLVAASIFTRYFESL--FGTEWRAQHPAIVRWFNT 194

  Fly   192 LEKLPYYEE 200
            :...|:.::
Yeast   195 VRASPFLKD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 44/198 (22%)
Thioredoxin_like 4..77 CDD:294274 15/66 (23%)
GST_C_Delta_Epsilon 91..209 CDD:198287 25/117 (21%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342 16/68 (24%)
GST_C_EF1Bgamma_like 92..214 CDD:198290 25/116 (22%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345097
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.