DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and URE2

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:245 Identity:61/245 - (24%)
Similarity:101/245 - (41%) Gaps:67/245 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLED---DGNYIW 66
            ||:....:|....|.:.|:.|...|..:.::.:..|..:.|::..||...||.|.|   |...||
Yeast   115 TLFSHRSAPNGFKVAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIW 179

  Fly    67 DSHAIIAYLVSKY---ADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLN--R 126
            :|.||:.:||:||   ..:..|:..||..::.::..|.|:|    :.....|.:.|.|...:  :
Yeast   180 ESGAILLHLVNKYYKETGNPLLWSDDLADQSQINAWLFFQT----SGHAPMIGQALHFRYFHSQK 240

  Fly   127 IPK--ERY-DAIVEIYDFVETFLAGH-----------------------------DY---IAGDQ 156
            |..  ||| |.:..:|..||..||..                             ||   :.||:
Yeast   241 IASAVERYTDEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWLVGDK 305

  Fly   157 LTIADFSLISSITSLVAFVE----IDR------LKYPRIIEWVRRLEKLP 196
            |||||          :|||.    :||      :::|.:.:|.:.:.:.|
Yeast   306 LTIAD----------LAFVPWNNVVDRIGINIKIEFPEVYKWTKHMMRRP 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 60/243 (25%)
Thioredoxin_like 4..77 CDD:294274 22/74 (30%)
GST_C_Delta_Epsilon 91..209 CDD:198287 33/153 (22%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 25/78 (32%)
GST_C_Ure2p 208..350 CDD:198326 33/152 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.