DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and TEF4

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_012842.1 Gene:TEF4 / 853781 SGDID:S000001564 Length:412 Species:Saccharomyces cerevisiae


Alignment Length:218 Identity:53/218 - (24%)
Similarity:94/218 - (43%) Gaps:27/218 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPT-LEDDGNYIWDS 68
            ||| :|.||...|.:..::..:|..:.|::     || |.|:....|....|. |...|..:.::
Yeast     5 TLY-INRSPRNYASEALISYFKLDVKIVDL-----EQ-SSEFASLFPLKQAPAFLGPKGLKLTEA 62

  Fly    69 HAIIAYLVSKYADSD---ALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKP-LFFNGLNRIPK 129
            .||..||.::.||..   .|...|:::::.:.:........|.:|    |.:| |.|.||....|
Yeast    63 LAIQFYLANQVADEKERARLLGSDVIEKSQILRWASLANSDVMSN----IARPFLSFKGLIPYNK 123

  Fly   130 ERYDA-IVEIYDFVETF---LAGHDYIAGDQLTIADFSLISS-ITSLVAFVEID-RLKYPRIIEW 188
            :..|| .|:|.:....|   |..:.::|.:.:::.|.....| ...|...:..: |.|:|.::.|
Yeast   124 KDVDACFVKIDNLAAVFDARLRDYTFVATENISLGDLHAAGSWAFGLATILGPEWRAKHPHLMRW 188

  Fly   189 VRR-----LEKLPYYEEANAKGA 206
            ...     :.|.|:.|...|:.|
Yeast   189 FNTVAASPIVKTPFAEVKLAEKA 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 49/206 (24%)
Thioredoxin_like 4..77 CDD:294274 21/72 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/128 (22%)
TEF4NP_012842.1 GST_N_EF1Bgamma 4..72 CDD:239342 21/73 (29%)
GST_C_EF1Bgamma_like 89..211 CDD:198290 27/125 (22%)
EF1G 253..356 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345110
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.