DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and YGR201C

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_011717.4 Gene:YGR201C / 853115 SGDID:S000003433 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:208 Identity:53/208 - (25%)
Similarity:86/208 - (41%) Gaps:39/208 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTL--EDDGNYIWDSHAIIA 73
            |...||::||            :|.::......:.|.::.|....||.  ..|...:.::.||..
Yeast    21 PRGLVRSLKL------------DVKLADPSDAQQLYEREFPLRKYPTFVGPHDEWTLTEAMAIDY 73

  Fly    74 YLVSKYADSDA----LYPR-DLLQRAVVDQRLHFE--TGVVFANGIKAITKPLF----FNGLN-R 126
            ||:...:|.:|    |.|. |...||.:   |.:|  :...|.|.:..:..||.    :|... :
Yeast    74 YLIHLSSDKEAVRQLLGPEGDFKTRADI---LRWESLSNSDFLNEVCEVFFPLIGVKPYNATEFK 135

  Fly   127 IPKERYDAIVEIYDFVETFLAGHDY-IAGDQLTIADFSLISSITSLVAFV----EIDRLKYPRII 186
            ..:|..|.||.:|   |..|....| :..|..|:||  |||:....:.|:    |..|.|:|.:.
Yeast   136 AARENVDTIVSLY---EKRLKKQQYLVCDDHETLAD--LISAAAFSLGFISFFDETWRSKHPEVT 195

  Fly   187 EWVRRLEKLPYYE 199
            .|..|:.|..::|
Yeast   196 RWFNRVIKSRFFE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 52/203 (26%)
Thioredoxin_like 4..77 CDD:294274 15/67 (22%)
GST_C_Delta_Epsilon 91..209 CDD:198287 33/121 (27%)
YGR201CNP_011717.4 Thioredoxin_like 4..78 CDD:412351 15/68 (22%)
GST_C_EF1Bgamma_like 98..220 CDD:198290 33/119 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345084
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.