DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GTT2

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:57/213 - (26%)
Similarity:97/213 - (45%) Gaps:29/213 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGVNPSPPVRAVKLTLAALQL--PYEFVNVNISGQEQLSEEYLKKNPEHTVPTLE-DDGNY 64
            |:.:|.....|....|::.||...:  ..:||.:|:...|....|:|.||...|||.|| |||..
Yeast    18 KMIIYDTPAGPYPARVRIALAEKNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPVLELDDGTL 82

  Fly    65 IWDSHAIIAYLVSKYADSDALYPRDLLQRAVV---DQRLHFE----TGVVFANGIKAI--TKPLF 120
            |.:..||..| :.....:..|..:..|::.|:   ::|...|    ..|.|.:....:  ...|:
Yeast    83 IAECTAITEY-IDALDGTPTLTGKTPLEKGVIHMMNKRAELELLDPVSVYFHHATPGLGPEVELY 146

  Fly   121 FN---GLNRIPKERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKY 182
            .|   ||    ::|..|:..::.| :|.|....|:|||..::||.::|:.:    .|..|.:|:.
Yeast   147 QNKEWGL----RQRDKALHGMHYF-DTVLRERPYVAGDSFSMADITVIAGL----IFAAIVKLQV 202

  Fly   183 PRIIE----WVRRLEKLP 196
            |...|    |.:|:::.|
Yeast   203 PEECEALRAWYKRMQQRP 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 55/210 (26%)
Thioredoxin_like 4..77 CDD:294274 25/75 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 30/122 (25%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 25/75 (33%)
GST_C_GTT2_like 106..222 CDD:198291 30/124 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345149
Domainoid 1 1.000 43 1.000 Domainoid score I3172
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1708
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.