DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and AT1G66235

DIOPT Version :10

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_683473.2 Gene:AT1G66235 / 842939 AraportID:AT1G66235 Length:284 Species:Arabidopsis thaliana


Alignment Length:64 Identity:16/64 - (25%)
Similarity:29/64 - (45%) Gaps:9/64 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KKNPEHTVPTLEDDGNYIWDSHAIIAYLV---SKYADSDALYPRDLLQRAVVDQRLHFETGVVF 108
            ||:.:..:.|:|.....:   ||.|....   |..|.||.::.:   .:.::.|..||::|..|
plant    58 KKSLQCRLQTIEKASKKL---HACIKLCENRRSSGASSDDIFNQ---AKEMLMQDKHFKSGWKF 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..210 CDD:440390 16/64 (25%)
AT1G66235NP_683473.2 NAM-associated 114..266 CDD:464129 1/2 (50%)

Return to query results.
Submit another query.