DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Clic4

DIOPT Version :10

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_114006.2 Gene:Clic4 / 83718 RGDID:61857 Length:253 Species:Rattus norvegicus


Alignment Length:151 Identity:35/151 - (23%)
Similarity:62/151 - (41%) Gaps:41/151 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VNVNISGQEQLSEE------YLKKNPEHTVPTLEDDGNYIWDSHAIIAYLVSKYADSDALYPRDL 90
            |..:::..|:..||      |||.:|:|  |.....|..|:...:  ||:.:...:::....|.|
  Rat    84 VKTDVNKIEEFLEEVLCPPKYLKLSPKH--PESNTAGMDIFAKFS--AYIKNSRPEANEALERGL 144

  Fly    91 LQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKE-RYDAIVEIYDFVETFLAGHDYIAG 154
            |:..   |:|.           :.:..||        |.| ..:::.:|......||      .|
  Rat   145 LKTL---QKLD-----------EYLNSPL--------PDEIDENSMEDIKSSTRRFL------DG 181

  Fly   155 DQLTIADFSLISS--ITSLVA 173
            |::|:||.:|:..  |..:||
  Rat   182 DEMTLADCNLLPKLHIVKVVA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..210 CDD:440390 35/151 (23%)
Clic4NP_114006.2 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 4/16 (25%)
O-ClC 17..252 CDD:129941 35/151 (23%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Y696 35..38
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.