DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Clic4

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_114006.1 Gene:Clic4 / 83718 RGDID:61857 Length:253 Species:Rattus norvegicus


Alignment Length:151 Identity:35/151 - (23%)
Similarity:62/151 - (41%) Gaps:41/151 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VNVNISGQEQLSEE------YLKKNPEHTVPTLEDDGNYIWDSHAIIAYLVSKYADSDALYPRDL 90
            |..:::..|:..||      |||.:|:|  |.....|..|:...:  ||:.:...:::....|.|
  Rat    84 VKTDVNKIEEFLEEVLCPPKYLKLSPKH--PESNTAGMDIFAKFS--AYIKNSRPEANEALERGL 144

  Fly    91 LQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKE-RYDAIVEIYDFVETFLAGHDYIAG 154
            |:..   |:|.           :.:..||        |.| ..:::.:|......||      .|
  Rat   145 LKTL---QKLD-----------EYLNSPL--------PGEIDENSMEDIKSSTRRFL------DG 181

  Fly   155 DQLTIADFSLISS--ITSLVA 173
            |::|:||.:|:..  |..:||
  Rat   182 DEMTLADCNLLPKLHIVKVVA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 35/151 (23%)
Thioredoxin_like 4..77 CDD:294274 14/50 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 19/86 (22%)
Clic4NP_114006.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 4/16 (25%)
GST_N_CLIC 14..104 CDD:239359 4/19 (21%)
O-ClC 17..252 CDD:129941 35/151 (23%)
GST_C_family 111..251 CDD:295467 27/124 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347857
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.