DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GSTT2

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:243 Identity:68/243 - (27%)
Similarity:114/243 - (46%) Gaps:36/243 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VKLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIW 66
            :||.:|....|.|.|||.:.....::.::.:.:::..::|||.|:.:.||...||.:.|....::
plant     1 MKLKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLF 65

  Fly    67 DSHAIIAYLVSKYAD-SDALYPRDLLQRAVVDQRLHFE--------TGVVFANGIKAITKPLFFN 122
            :||||:.||.|.||. .|..||.||.:||.:...|.:.        :|.|    :.::..|..  
plant    66 ESHAILIYLSSAYASVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYV----LNSVLAPAL-- 124

  Fly   123 GLNRIPK---ERYDAIVEIYDFVETF-LAGHD--YIAGDQLTIADFSLISSITSLVAFVEIDRLK 181
            ||...||   |..:.:......:||| |.|..  .:.|.|.:|||.||:..:..|....:.|||:
plant   125 GLPLNPKAAAEAENILTNSLSTLETFWLKGSAKFLLGGKQPSIADLSLVCELMQLQVLDDKDRLR 189

  Fly   182 ----YPRIIEWVRRLEK--LPYYEEAN-----AKG----ARELETILK 214
                :.::.:|:....|  :|:.:|.:     ||.    .||:.|..|
plant   190 LLSPHKKVEQWIESTRKATMPHSDEVHEVLFRAKDRFQKQREMATASK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 59/212 (28%)
Thioredoxin_like 4..77 CDD:294274 22/72 (31%)
GST_C_Delta_Epsilon 91..209 CDD:198287 34/146 (23%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 23/74 (31%)
GST_C_Theta 92..221 CDD:198292 31/134 (23%)
NAM-associated 380..>515 CDD:405060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.