DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GSTT1

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_198937.1 Gene:GSTT1 / 834123 AraportID:AT5G41210 Length:245 Species:Arabidopsis thaliana


Alignment Length:244 Identity:66/244 - (27%)
Similarity:119/244 - (48%) Gaps:36/244 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYI 65
            |:||.:|....|.|.|||.:......:.::.|.::::.::|||.|:...||...||.:.|....:
plant     1 MMKLKVYADRMSQPSRAVIIFCKVNGIQFDEVLISLAKRQQLSPEFKDINPLGKVPAIVDGRLKL 65

  Fly    66 WDSHAIIAYLVSKYAD-SDALYPRDLLQRAVVDQRLHFE--------TGVVFANGIKAITKPLFF 121
            ::||||:.||.|.:.. :|..||.||.:||.:...|.:.        .|.|    :.::..|.. 
plant    66 FESHAILIYLSSAFPSVADHWYPNDLSKRAKIHSVLDWHHTNLRRGAAGYV----LNSVLGPAL- 125

  Fly   122 NGLNRIPKERYDA---IVEIYDFVETF-LAGH-DYIAG-DQLTIADFSLISSITSLVAFVEIDRL 180
             ||...||...:|   :.:....:||| |.|: .::.| :|.:|||.||:..:..|....:.|||
plant   126 -GLPLNPKAAAEAEQLLTKSLSTLETFWLKGNAKFLLGSNQPSIADLSLVCELMQLQVLDDKDRL 189

  Fly   181 K----YPRIIEWVRRLEK--LPYYEEANA---------KGARELETILK 214
            :    :.::.:|:...:|  :|:::|.:.         :..||:.|:.|
plant   190 RLLSTHKKVEQWIENTKKATMPHFDETHEILFKVKEGFQKRREMGTLSK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 58/212 (27%)
Thioredoxin_like 4..77 CDD:294274 23/72 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 32/146 (22%)
GSTT1NP_198937.1 GST_N_Theta 4..79 CDD:239348 24/74 (32%)
GST_C_Theta 93..223 CDD:198292 31/135 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.