DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GSTF2

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:230 Identity:57/230 - (24%)
Similarity:93/230 - (40%) Gaps:50/230 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYI 65
            |..:.::|...|...|.|.:.|....|.:|.|:|.:...|...|.:|.:||...||..||....:
plant     1 MAGIKVFGHPASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKL 65

  Fly    66 WDSHAIIAYLVSKYAD-------SDALYPRDLLQRAV--------------VDQRLHFETGVVFA 109
            ::|.||..|:..:|.:       :|:   :::.|.|:              |..:|.||      
plant    66 FESRAITQYIAHRYENQGTNLLQTDS---KNISQYAIMAIGMQVEDHQFDPVASKLAFE------ 121

  Fly   110 NGIKAITKPLFFNGL---NRIPKERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSL 171
                .|.|.::  ||   ..:..|....:.::.|..|..|....|:||:..|:.|...|.:|..|
plant   122 ----QIFKSIY--GLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYL 180

  Fly   172 VA------FVEIDRLKYPRIIEWVRRLEKLPYYEE 200
            :.      |.|     .||:.|||..:.|.|..|:
plant   181 LGTPTKKLFTE-----RPRVNEWVAEITKRPASEK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 54/221 (24%)
Thioredoxin_like 4..77 CDD:294274 22/72 (31%)
GST_C_Delta_Epsilon 91..209 CDD:198287 32/133 (24%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 22/73 (30%)
GST_C_Phi 96..211 CDD:198296 32/132 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.