DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GSTF10

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:220 Identity:61/220 - (27%)
Similarity:100/220 - (45%) Gaps:31/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDS 68
            ||:|....:...||| :||....:.:|.|||::...||...|||...|...:|.|.|....|::|
plant     3 LTIYAPLFASSKRAV-VTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFES 66

  Fly    69 HAIIAYLVSKY-ADSDALYPRDLLQRAVVDQRLHFET------------GVVFANGIKAITKPLF 120
            .||:.|:..|| :....|..:.:.:|..|:|.|..|.            .:|||        ||.
plant    67 RAIMRYIAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFA--------PLM 123

  Fly   121 -FNGLNRIPKERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLV-----AFVEIDR 179
             |....::.||..:.:.|:.|..|..|:.::|:|||.:::||.:.:.....||     |.:..||
plant   124 GFPADEKVIKESEEKLAEVLDVYEAQLSKNEYLAGDFVSLADLAHLPFTEYLVGPIGKAHLIKDR 188

  Fly   180 LKYPRIIEWVRRLEKLPYYEEANAK 204
               ..:..|..::.....::|.:||
plant   189 ---KHVSAWWDKISSRAAWKEVSAK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 58/210 (28%)
Thioredoxin_like 4..77 CDD:294274 26/72 (36%)
GST_C_Delta_Epsilon 91..209 CDD:198287 32/132 (24%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 61/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.