DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GSTF9

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_180643.1 Gene:GSTF9 / 817636 AraportID:AT2G30860 Length:215 Species:Arabidopsis thaliana


Alignment Length:217 Identity:56/217 - (25%)
Similarity:95/217 - (43%) Gaps:25/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDS 68
            |.:||.:.:.|.||: :||....:.:|.:.|::...|.....||...|..|||.:.|....|::|
plant     3 LKVYGPHFASPKRAL-VTLIEKGVAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIFES 66

  Fly    69 HAIIAYLVSKYADSDALYPRDLLQRAV-----VDQRLHFETGVVFANGIKAITKPLFFNGLNRIP 128
            .|::.|:..||.....    |||.:.|     |:|.|..| ...:...:..:|..:.|..:...|
plant    67 RAVMRYVAEKYRSQGP----DLLGKTVEDRGQVEQWLDVE-ATTYHPPLLNLTLHIMFASVMGFP 126

  Fly   129 ------KERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLV-----AFVEIDRLKY 182
                  ||..:.:..:.|..|..|:...|:|||.:::||.:.:.....||     |::..||   
plant   127 SDEKLIKESEEKLAGVLDVYEAHLSKSKYLAGDFVSLADLAHLPFTDYLVGPIGKAYMIKDR--- 188

  Fly   183 PRIIEWVRRLEKLPYYEEANAK 204
            ..:..|...:...|.::|..||
plant   189 KHVSAWWDDISSRPAWKETVAK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 52/207 (25%)
Thioredoxin_like 4..77 CDD:294274 22/72 (31%)
GST_C_Delta_Epsilon 91..209 CDD:198287 30/130 (23%)
GSTF9NP_180643.1 PLN02395 1..215 CDD:166036 56/217 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4833
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.