DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Clic3

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_030107910.1 Gene:Clic3 / 69454 MGIID:1916704 Length:268 Species:Mus musculus


Alignment Length:210 Identity:40/210 - (19%)
Similarity:79/210 - (37%) Gaps:30/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDSHAIIA 73
            |...|..:.:.:.|....:|:....|:......:.:::.   |...:|.|..||:...|:..|..
Mouse    51 VGHCPSCQRLFMVLLLKGVPFTLTTVDTRRALDVLKDFA---PGSQLPILLYDGDVKTDTLQIEE 112

  Fly    74 YLVSKYADSD--ALYPR---------DLLQR--AVVDQRLHFETGVVFANGIKAITKPLFFNGLN 125
            :|.......|  :|.||         |:..:  |.:...:..:...::...::|:|:   .:...
Mouse   113 FLEETLGPPDFPSLAPRYRESNTAGNDIFHKFSAFIKNPVPTQDNALYQQLLRALTR---LDSYL 174

  Fly   126 RIPKERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSL-VAFVEIDRLKYPRIIEWV 189
            |.|.:.     |:........:...::.|||.|:||.||:..:..: .......:|..|..:..|
Mouse   175 RAPLDH-----ELAQEPHLRESHRRFLDGDQFTLADCSLLPKLHIVDTVCAHFRQLPIPAELSCV 234

  Fly   190 RRLEKLPYYEEANAK 204
            ||     |.:.|..|
Mouse   235 RR-----YLDSALQK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 37/200 (19%)
Thioredoxin_like 4..77 CDD:294274 13/67 (19%)
GST_C_Delta_Epsilon 91..209 CDD:198287 22/117 (19%)
Clic3XP_030107910.1 O-ClC 43..261 CDD:129941 40/210 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844733
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.