DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Gsto2

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_080895.2 Gene:Gsto2 / 68214 MGIID:1915464 Length:248 Species:Mus musculus


Alignment Length:199 Identity:41/199 - (20%)
Similarity:74/199 - (37%) Gaps:45/199 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDG-NYIWD 67
            :.:|.:...|.....:|.|.|..:.:|.:|:|:..:   .:.|..|:|...:|.||:.. ..:::
Mouse    24 IRIYSMRFCPYSHRARLVLKAKGIRHEVININLKSK---PDWYYTKHPFGQIPVLENSQCQLVYE 85

  Fly    68 SHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFF--------NGL 124
            |.....||...| ....|:|.|..:||  .|::..|   :|.. :..::|....        ..|
Mouse    86 SVIACEYLDDVY-PGRKLFPYDPYERA--RQKMLLE---LFCK-VPPLSKECLIALRCGRDCTDL 143

  Fly   125 NRIPKERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWV 189
            ....::....:.||.::..|...|.|.|:                      .||.|.:|    |.
Mouse   144 KVALRQELCNMEEILEYQNTTFFGGDCIS----------------------MIDYLVWP----WF 182

  Fly   190 RRLE 193
            .||:
Mouse   183 ERLD 186

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 41/199 (21%)
Thioredoxin_like 4..77 CDD:294274 17/73 (23%)
GST_C_Delta_Epsilon 91..209 CDD:198287 20/111 (18%)
Gsto2NP_080895.2 GST_N_Omega 6..94 CDD:239353 16/72 (22%)