DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GstD10

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:208 Identity:71/208 - (34%)
Similarity:118/208 - (56%) Gaps:8/208 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGVNPSPPVRAVKLTLAALQLPYEFVN-VNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWD 67
            :.||....|.|.|:|.:|..||.:.::... :|...:||.:.||||.||:||:|||.|.|..:|:
  Fly     1 MDLYYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLKINPQHTIPTLHDHGFALWE 65

  Fly    68 SHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERY 132
            |.||:.|||.||...|.|:|:|:.::|:::|||:|:.|.::.:..:.....:|..  ....:|.|
  Fly    66 SRAIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYYYPQIFLK--KPANEENY 128

  Fly   133 DAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSL-VAFVEIDRLKYPRIIEWVRRLEKL- 195
            ..|...::|:.|||.|..|.||...::||.:.::::::. ||..:..|  |..:..|....:|| 
  Fly   129 KKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFKR--YANVARWYENAKKLT 191

  Fly   196 PYYEEANAKGARE 208
            |.:|| |..|.:|
  Fly   192 PGWEE-NWAGCQE 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 65/194 (34%)
Thioredoxin_like 4..77 CDD:294274 31/73 (42%)
GST_C_Delta_Epsilon 91..209 CDD:198287 33/120 (28%)
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 31/73 (42%)
PLN02473 3..196 CDD:166114 66/196 (34%)
GST_C_Delta_Epsilon 89..205 CDD:198287 33/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460283
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
109.900

Return to query results.
Submit another query.