DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and gstt1a

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001314691.1 Gene:gstt1a / 563972 ZFINID:ZDB-GENE-031001-13 Length:242 Species:Danio rerio


Alignment Length:214 Identity:62/214 - (28%)
Similarity:110/214 - (51%) Gaps:20/214 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDS 68
            |.||....|.|.|:|.:.....::|:|:..|::|..||..:|:.|.:....||.|:|....:.:|
Zfish     3 LELYLDLHSQPCRSVFIFAKINKIPFEYKAVDLSAGEQYGDEFGKVSIIRKVPALKDGDFLLTES 67

  Fly    69 HAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGL------NRI 127
            .||:.||..|::..|..||.||.:||.||:.|.::...:.::|    :|..:|.|:      ..:
Zfish    68 IAILLYLAGKHSTPDHWYPADLQKRAQVDEFLSWQHTNIRSHG----SKVFWFKGVLPAVTGAPV 128

  Fly   128 PKERYDAIVE-----IYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLK-YPRII 186
            |||:.|:.:|     :..|.:.||....:|.||::::||...|..:...|| ..:|..: .|.:.
Zfish   129 PKEKMDSALEDLNMSLKIFEDKFLQSRPFIIGDKISLADIVAIVEMMQPVA-TGVDVFEGRPALS 192

  Fly   187 EWVRRLEK---LPYYEEAN 202
            .|..|::|   :..::||:
Zfish   193 AWRDRVKKEVGVELFDEAH 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 60/206 (29%)
Thioredoxin_like 4..77 CDD:294274 24/72 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 32/127 (25%)
gstt1aNP_001314691.1 GstA 3..199 CDD:223698 59/200 (30%)
GST_N_Theta 3..78 CDD:239348 24/74 (32%)
GST_C_Theta 91..217 CDD:198292 32/126 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.