Sequence 1: | NP_611327.1 | Gene: | GstE5 / 37110 | FlyBaseID: | FBgn0063495 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_687373.1 | Gene: | gdap1l1 / 562163 | ZFINID: | ZDB-GENE-080812-2 | Length: | 367 | Species: | Danio rerio |
Alignment Length: | 264 | Identity: | 52/264 - (19%) |
---|---|---|---|
Similarity: | 91/264 - (34%) | Gaps: | 75/264 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWD 67
Fly 68 SHAIIAYLVSKY-ADSDA-LYP-------------RDLLQRAVVDQRLH---------------- 101
Fly 102 FETGVV---FANGI----------------------KAITKPLFFNGLNRIPKERYDAIVEIYDF 141
Fly 142 VETFLAGHD----------YIAGDQLTIADFSLISSITSLVAFVEIDRLKY------PRIIEWVR 190
Fly 191 RLEK 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE5 | NP_611327.1 | GstA | 4..196 | CDD:223698 | 52/263 (20%) |
Thioredoxin_like | 4..77 | CDD:294274 | 18/72 (25%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 28/161 (17%) | ||
gdap1l1 | XP_687373.1 | GstA | 48..314 | CDD:223698 | 52/263 (20%) |
Thioredoxin_like | 48..120 | CDD:294274 | 18/71 (25%) | ||
GST_C_GDAP1L1 | 201..311 | CDD:198335 | 22/110 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589690 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |