DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and gdap1l1

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:264 Identity:52/264 - (19%)
Similarity:91/264 - (34%) Gaps:75/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWD 67
            :|.||....|...:.|:|.:....|..|..:|::...||....:::.|....||........:.|
Zfish    47 RLVLYHWTQSFSSQKVRLVINEKGLLCEERDVSLPLTEQKEPWFMRLNLGEEVPVFIHGDTIVSD 111

  Fly    68 SHAIIAYLVSKY-ADSDA-LYP-------------RDLLQRAVVDQRLH---------------- 101
            .:.||.|:.:.: .|:.| |.|             |:||....:|...|                
Zfish   112 YNQIIDYIETNFVGDTVAQLIPDEGTPMYARVQQYRELLDGLPMDAYTHGCILHPELTTDSMIPK 176

  Fly   102 FETGVV---FANGI----------------------KAITKPLFFNGLNRIPKERYDAIVEIYDF 141
            :.|..:   .||..                      |.:.|.|..:.:|.: |:....:..:.|.
Zfish   177 YATAEIRRHLANAASELMKLDHEEPQLTEPYLSKQKKLMAKILDHDNVNYL-KKILGELAMVLDQ 240

  Fly   142 VETFLAGHD----------YIAGDQLTIADFSLISSITSLVAFVEIDRLKY------PRIIEWVR 190
            ||..|....          ::.|...|:||..|.:::..| .|:.:.| ||      |.:..:..
Zfish   241 VEAELEKRKLEYQGQKCELWLCGPTFTLADICLGATLHRL-KFLGLSR-KYWEDGSRPNLQSFFE 303

  Fly   191 RLEK 194
            |::|
Zfish   304 RVQK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 52/263 (20%)
Thioredoxin_like 4..77 CDD:294274 18/72 (25%)
GST_C_Delta_Epsilon 91..209 CDD:198287 28/161 (17%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 52/263 (20%)
Thioredoxin_like 48..120 CDD:294274 18/71 (25%)
GST_C_GDAP1L1 201..311 CDD:198335 22/110 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589690
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.