DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and gdap1

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001018511.1 Gene:gdap1 / 553702 ZFINID:ZDB-GENE-050522-424 Length:362 Species:Danio rerio


Alignment Length:270 Identity:60/270 - (22%)
Similarity:89/270 - (32%) Gaps:85/270 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWD 67
            ||.||....|...:.|:|.:|...|..|..:|::...|.....:::.||...||.|..|.:.|.|
Zfish    39 KLILYHWTQSFSSQKVRLAIAEKGLQCEDYDVSLPLSEHNEPWFMRLNPTGEVPVLVHDNHVICD 103

  Fly    68 SHAIIAYLVSKYADSDA--LYP-------------RDLLQRAVVDQRLHFETGVVFANGIK---- 113
            ...|:.||...:.|...  |.|             |:||....:|...|   |.:....|.    
Zfish   104 PTQIMDYLEQNFCDEQTPKLIPEEGSTYYHRVQHYRELLDSLQMDAYTH---GCILHPEITVDSH 165

  Fly   114 -----------------------AITKP----------------LFFNGLNRIPKERYDAIVEIY 139
                                   |:..|                ||.:...:..|:..|.:..:.
Zfish   166 IPAYATTHIRTQIGNTESELKKLAVENPDLKDAYIAKQRRLKSKLFDHDNMKYLKKLLDELENVL 230

  Fly   140 DFVETFL-----------AGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIE--WVR- 190
            |.|||.|           :...::.||..:|||.||.         |.:.|||:..:..  |.. 
Zfish   231 DQVETELQRRSEETPEEGSQQAWLCGDFFSIADVSLA---------VTLHRLKFLGLSRRYWGNG 286

  Fly   191 -RLEKLPYYE 199
             |:....|||
Zfish   287 MRVNLETYYE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 56/264 (21%)
Thioredoxin_like 4..77 CDD:294274 22/72 (31%)
GST_C_Delta_Epsilon 91..209 CDD:198287 32/167 (19%)
gdap1NP_001018511.1 GstA 40..307 CDD:223698 59/269 (22%)
GST_N_GDAP1 40..112 CDD:239350 21/71 (30%)
GST_C_family 193..304 CDD:295467 26/113 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589744
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.