Sequence 1: | NP_611327.1 | Gene: | GstE5 / 37110 | FlyBaseID: | FBgn0063495 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018511.1 | Gene: | gdap1 / 553702 | ZFINID: | ZDB-GENE-050522-424 | Length: | 362 | Species: | Danio rerio |
Alignment Length: | 270 | Identity: | 60/270 - (22%) |
---|---|---|---|
Similarity: | 89/270 - (32%) | Gaps: | 85/270 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWD 67
Fly 68 SHAIIAYLVSKYADSDA--LYP-------------RDLLQRAVVDQRLHFETGVVFANGIK---- 113
Fly 114 -----------------------AITKP----------------LFFNGLNRIPKERYDAIVEIY 139
Fly 140 DFVETFL-----------AGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIE--WVR- 190
Fly 191 -RLEKLPYYE 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstE5 | NP_611327.1 | GstA | 4..196 | CDD:223698 | 56/264 (21%) |
Thioredoxin_like | 4..77 | CDD:294274 | 22/72 (31%) | ||
GST_C_Delta_Epsilon | 91..209 | CDD:198287 | 32/167 (19%) | ||
gdap1 | NP_001018511.1 | GstA | 40..307 | CDD:223698 | 59/269 (22%) |
GST_N_GDAP1 | 40..112 | CDD:239350 | 21/71 (30%) | ||
GST_C_family | 193..304 | CDD:295467 | 26/113 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589744 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |