DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and CLIC6

DIOPT Version :10

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001303938.1 Gene:CLIC6 / 54102 HGNCID:2065 Length:704 Species:Homo sapiens


Alignment Length:151 Identity:34/151 - (22%)
Similarity:65/151 - (43%) Gaps:41/151 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VNVNISGQEQLSEE------YLKKNPEHTVPTLEDDGNYIWDSHAIIAYLVSKYADSDALYPRDL 90
            |..:::..|:..||      |.|...:|  |.....||.::...:  |::.:...|::.::.::|
Human   536 VKTDVNKIEEFLEEKLAPPRYPKLGTQH--PESNSAGNDVFAKFS--AFIKNTKKDANEIHEKNL 596

  Fly    91 LQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNR-IPKERYDAIVEIYDFVETFLAGHDYIAG 154
            |                     ||:.|  ..|.||. :|.|     ::.|...:..::|..::.|
Human   597 L---------------------KALRK--LDNYLNSPLPDE-----IDAYSTEDVTVSGRKFLDG 633

  Fly   155 DQLTIADFSLISS--ITSLVA 173
            |:||:||.:|:..  |..:||
Human   634 DELTLADCNLLPKLHIIKIVA 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..210 CDD:440390 34/151 (23%)
CLIC6NP_001303938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..446
PRK07764 <9..382 CDD:236090
13 X 10 AA tandem repeat of G-D-[SNG]-[VIM]-[DEQ]-A-[EAG]-[GDVE]-[PRG]-[LAVP] 157..282
O-ClC 471..704 CDD:129941 34/151 (23%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Y696 487..490
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.