DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and CLIC5

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001107558.1 Gene:CLIC5 / 53405 HGNCID:13517 Length:410 Species:Homo sapiens


Alignment Length:260 Identity:50/260 - (19%)
Similarity:85/260 - (32%) Gaps:114/260 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PYEFVNVNISG------QEQLSEEYLKKNPEHTVPTLEDDGNY-IWDSHAIIAYLVSKYADSDAL 85
            |.|...:::.|      .:||....|::|.......|....:: |..|.|......|.|:|::.|
Human    99 PQEDRGISMEGLYSSTQDQQLCAAELQENGSVMKEDLPSPSSFTIQHSKAFSTTKYSCYSDAEGL 163

  Fly    86 YPRD---------LLQRAVVD----------QRLH---FETGVVF-------------ANGIKAI 115
            ..::         |..:|.:|          |||.   :..||||             .:.:...
Human   164 EEKEGAHMNPEIYLFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPG 228

  Fly   116 TKPLF--FNG-----LNRIPK--------ERY--------------------------------- 132
            |.|.|  |||     :|:|.:        |:|                                 
Human   229 THPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFSKFSAYIKNTKQQNN 293

  Fly   133 --------DAIVEIYDFVETFL--------AGHD------YIAGDQLTIADFSLISS--ITSLVA 173
                    .|:.::.|::.|.|        .|.|      ::.||:||:||.:|:..  :..:||
Human   294 AALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDELTLADCNLLPKLHVVKIVA 358

  Fly   174  173
            Human   359  358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 50/260 (19%)
Thioredoxin_like 4..77 CDD:294274 11/55 (20%)
GST_C_Delta_Epsilon 91..209 CDD:198287 34/181 (19%)
CLIC5NP_001107558.1 O-ClC 173..408 CDD:129941 35/186 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154561
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.