DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Gstt3

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:227 Identity:57/227 - (25%)
Similarity:106/227 - (46%) Gaps:27/227 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDS 68
            |.||....|.|.|||.:......:|::...:.:...:..::.:.:.||...||.|:|....:.:|
  Rat    60 LELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQHYTDAFAQVNPLRKVPALKDGDFVLAES 124

  Fly    69 HAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITK----PLFFNGLNRIPK 129
            .||:.||..||...|..||:||..||.||:.|.::...:.:...:|:.:    |:|..  ..:|.
  Rat   125 VAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHTALRSCCSRAMWQKMMFPVFLG--QPVPP 187

  Fly   130 ER-------YDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLV-AFVEIDRLKYPRII 186
            ||       .|..:::.:  :.||....::.|..:::||...|:.:...| |..:|...: |::.
  Rat   188 ERLASTLAELDGCLQMLE--DKFLQNKAFLTGPHISVADLVAITELMHPVSAGCKIFESR-PKLA 249

  Fly   187 EWVRRLEKL---PYYEEANAKGARELETILKS 215
            .|.:|:|..   ..::||:       |.:||:
  Rat   250 AWRQRVEAAVGESLFQEAH-------EVVLKA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 52/206 (25%)
Thioredoxin_like 4..77 CDD:294274 20/72 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 27/132 (20%)
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 20/74 (27%)
GST_C_Theta 149..273 CDD:198292 28/135 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348142
Domainoid 1 1.000 62 1.000 Domainoid score I10049
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.650

Return to query results.
Submit another query.