DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and clic4

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001007908.1 Gene:clic4 / 493290 XenbaseID:XB-GENE-958154 Length:252 Species:Xenopus tropicalis


Alignment Length:201 Identity:37/201 - (18%)
Similarity:73/201 - (36%) Gaps:65/201 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VNVNISGQEQLSEEYL---------KKNPEHTVPTLEDDGNYIWDSHAIIAYLVSKYADSDALYP 87
            |..:::..|:..||.|         .|:||.....::....:       .||:.:...|::....
 Frog    83 VKTDVNKIEEFLEEVLCPPKYRKLAAKHPESNTAGMDIFAKF-------SAYIKNSRPDNNEALE 140

  Fly    88 RDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERYDAIVEIYDFVETFLAGHDYI 152
            |.||:..   |:|.           ..:..||    .:.|.:...|.|.:         :...::
 Frog   141 RGLLKTL---QKLD-----------DYLNSPL----PDEIDENSMDDITQ---------SNRKFL 178

  Fly   153 AGDQLTIADFSLISSITSLVAFVEIDRLKY-----PRIIEWVRRLEKLPYYEEANAK-------- 204
            .|:::|:||.:|:..:    ..:::...||     |:.:..:.|     |...|.:|        
 Frog   179 DGEEMTLADCNLLPKL----HIIKVVTKKYRGFEIPKSMTGIWR-----YLSNAYSKDEFTNTCP 234

  Fly   205 GARELE 210
            |.||:|
 Frog   235 GDREIE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 30/177 (17%)
Thioredoxin_like 4..77 CDD:294274 10/53 (19%)
GST_C_Delta_Epsilon 91..209 CDD:198287 22/130 (17%)
clic4NP_001007908.1 O-ClC 17..250 CDD:129941 37/201 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.