DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and clic5a

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001007386.1 Gene:clic5a / 492513 ZFINID:ZDB-GENE-041114-84 Length:246 Species:Danio rerio


Alignment Length:143 Identity:30/143 - (20%)
Similarity:58/143 - (40%) Gaps:37/143 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VNVNISGQEQLSEEYL--KKNPEHTVPTLEDD--GNYIWDSHAIIAYLVSKYADSDALYPRDLLQ 92
            |..:::..|:..||.|  .|.|:......|.:  ||.|:...:  ||:.:...:::|...:.||:
Zfish    77 VRTDVNKIEEFLEEMLAPPKYPKLAAKNKESNTAGNDIFAKFS--AYIKNTKPEANASLEKGLLK 139

  Fly    93 RAVVDQRLHFETGVVFANGIKAITKPL--FFNGLNRIPKERYDAIVEIYDFVETFLAGHDYIAGD 155
                                  :.|.|  |.|  :.:|.|     ::.....|...:...|:.|:
Zfish   140 ----------------------VLKKLDSFLN--SPLPDE-----IDAESTGEEKSSNRKYLDGN 175

  Fly   156 QLTIADFSLISSI 168
            :||:||.:|:..:
Zfish   176 ELTLADCNLLPKL 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 30/143 (21%)
Thioredoxin_like 4..77 CDD:294274 13/48 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 15/80 (19%)
clic5aNP_001007386.1 GST_N_CLIC 8..97 CDD:239359 5/19 (26%)
O-ClC 10..244 CDD:129941 30/143 (21%)
GST_C_CLIC5 104..244 CDD:198330 23/116 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.