DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and gsto2

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001007373.1 Gene:gsto2 / 492500 ZFINID:ZDB-GENE-041114-67 Length:240 Species:Danio rerio


Alignment Length:241 Identity:53/241 - (21%)
Similarity:90/241 - (37%) Gaps:70/241 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLE-DDGNYIW 66
            ::.||.:...|..:..:|.|.|..:.::.:|:|:..:   .:.:|||||..|||.|| ..|..|:
Zfish    22 QIRLYSMRFCPFAQRTRLVLTAKGVKHDIININLVSK---PDWFLKKNPFGTVPVLETSSGQVIY 83

  Fly    67 DSHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKER 131
            :|.....||...|.:. .|.|.|..:||.....|...:.|:          |.|:. ::...|..
Zfish    84 ESPITCEYLDEVYPEK-KLLPSDPFERAQQKMLLELYSKVI----------PYFYK-ISMGKKRG 136

  Fly   132 YDAIVEIYDFVETFLAGHD--------YIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEW 188
            .|......:|.|..|..::        |..||.:|:.|:.:                       |
Zfish   137 EDVSTAEAEFTEKLLQLNEALANKKTKYFGGDSITMIDYLI-----------------------W 178

  Fly   189 VRRLEKLPYYEEANAKGAR-------------EL---ETILKSTNF 218
                   |::|.|...|.:             ||   :.::|:|.|
Zfish   179 -------PWFERAEMMGVKHCLAKTPELRKWIELMFEDPVVKATMF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 44/200 (22%)
Thioredoxin_like 4..77 CDD:294274 23/73 (32%)
GST_C_Delta_Epsilon 91..209 CDD:198287 21/138 (15%)
gsto2NP_001007373.1 GST_N_Omega 4..93 CDD:239353 22/73 (30%)
GstA 25..210 CDD:223698 50/229 (22%)
GST_C_Omega 107..229 CDD:198293 26/152 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589499
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.