DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GstD8

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster


Alignment Length:207 Identity:77/207 - (37%)
Similarity:121/207 - (58%) Gaps:5/207 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDSHAIIAYLV 76
            |.|.|:|.:|..||.:......:.:...|||..|::|.||:|.:|||.|||..||:|.||:.|||
  Fly     9 SAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIWESRAILIYLV 73

  Fly    77 SKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKERYDAIVEIYDF 141
            .||...|:|||.|..::|||:|||:|:.|.:|.:.::|| .|...|.....| |....:...:..
  Fly    74 EKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAI-YPQIRNNHPADP-EAMQKVDSAFGH 136

  Fly   142 VETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVRRLEKL-PYYEEANAKG 205
            ::|||...:|:|||.|||||.:|::|: |....|:.|..:||.:..|....::: |.:|| |..|
  Fly   137 LDTFLEDQEYVAGDCLTIADIALLASV-STFEVVDFDIAQYPNVARWYENAKEVTPGWEE-NWDG 199

  Fly   206 ARELETILKSTN 217
            .:.::.:::..|
  Fly   200 VQLIKKLVQERN 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 71/184 (39%)
Thioredoxin_like 4..77 CDD:294274 28/64 (44%)
GST_C_Delta_Epsilon 91..209 CDD:198287 40/118 (34%)
GstD8NP_524916.1 GstA 1..188 CDD:223698 71/181 (39%)
GST_N_Delta_Epsilon 1..74 CDD:239343 28/64 (44%)
GST_C_Delta_Epsilon 88..204 CDD:198287 40/119 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460270
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.