DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GstD7

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster


Alignment Length:224 Identity:78/224 - (34%)
Similarity:124/224 - (55%) Gaps:20/224 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYI 65
            |..|.||....:|..||:::...||.|......:|....:||..|:::.||:||:|||.|:|..|
  Fly     1 MPNLDLYNFPMAPASRAIQMVAKALGLELNSKLINTMEGDQLKPEFVRINPQHTIPTLVDNGFVI 65

  Fly    66 WDSHAIIAYLVSKYADSDA-LYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPK 129
            |:|.||..|||.||...|: |||.|..:||:::|||:|:.|.::    .|:||..|.  :.|..|
  Fly    66 WESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLY----DALTKYFFL--IFRTGK 124

  Fly   130 ----ERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVR 190
                |..|.:...:.|:.|||.|.|::||.|||:||..::::: |.|.:...|..|:|.:..|::
  Fly   125 FGDQEALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATV-STVEWFSFDLSKFPNVERWLK 188

  Fly   191 RLEKL-PYYEEANAKGARELETILKSTNF 218
            ...|: |.:|:       .||::.:...|
  Fly   189 NAPKVTPGWEQ-------NLESLQQGKKF 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 72/197 (37%)
Thioredoxin_like 4..77 CDD:294274 29/72 (40%)
GST_C_Delta_Epsilon 91..209 CDD:198287 37/122 (30%)
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 29/72 (40%)
GstA 6..188 CDD:223698 70/188 (37%)
GST_C_Delta_Epsilon 92..206 CDD:198287 39/127 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460335
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1110.800

Return to query results.
Submit another query.