DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and gstt1

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001006811.1 Gene:gstt1 / 448525 XenbaseID:XB-GENE-998695 Length:242 Species:Xenopus tropicalis


Alignment Length:253 Identity:80/253 - (31%)
Similarity:118/253 - (46%) Gaps:55/253 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYI 65
            |.:||||....|.|.|:|.:...|..:|:....|.:...|.|:|||.|.|....||.|:|...::
 Frog     1 MAELTLYLDLLSQPCRSVYIFAKANNIPFNNHQVRLFKGEHLTEEYGKVNVLRKVPALKDCDFFM 65

  Fly    66 WDSHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANG-----IKAITKPLFFNGLN 125
            .:|.|::.|:..|:..:|..||.|:.:.|.||:.|.::......||     :|.:| ||...  .
 Frog    66 AESTAMLLYMARKFKTADHWYPSDIQKCAKVDEYLAWQHTNTRPNGSKVFWVKCLT-PLILG--Q 127

  Fly   126 RIPKERYDAIVEIY-----DFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEI-------- 177
            ..|.|:.||:|..:     :|.|.||....:||||::::||         |||.|||        
 Frog   128 EAPAEKVDAVVAEFNTTMNNFEEKFLGNKLFIAGDEISVAD---------LVAIVEIMQVVAGGI 183

  Fly   178 ----DRLKYPRIIEWVRRL-----EKLPYYEEA-----NAKG------ARELETILKS 215
                ||   |::..|.:|:     |:|  :.||     |||.      |.||...|||
 Frog   184 NVFDDR---PKLAAWKKRVVEALGEEL--FLEAHEGILNAKKMASEPLAPELMEFLKS 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 67/218 (31%)
Thioredoxin_like 4..77 CDD:294274 25/72 (35%)
GST_C_Delta_Epsilon 91..209 CDD:198287 44/155 (28%)
gstt1NP_001006811.1 GST_N_Theta 4..79 CDD:239348 25/74 (34%)
GST_C_Theta 92..217 CDD:198292 40/141 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.