DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GstD11

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster


Alignment Length:216 Identity:79/216 - (36%)
Similarity:120/216 - (55%) Gaps:12/216 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDSHA 70
            ||.:.||||.|::.|....|.:.:|...|||...|||..:::..||:|.|||:.|:|..:|:|.|
  Fly    27 LYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRA 91

  Fly    71 IIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITK---PLFFNGLNRIPKERY 132
            |::|||:.|..||.|||.|:..||:|||||.|:.|.::..    :|.   |..|.|. .:.:.:.
  Fly    92 ILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMR----LTDYYFPTMFIGA-PLDEGKR 151

  Fly   133 DAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVRRLE--KL 195
            ..:.|...::.|.|.|..:.|.|..||||.:|:.:::.|.|| |.:...|..|.:|:.|.:  ..
  Fly   152 AKLAEAVGWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAF-EFELRPYKHIRQWLDRCKDHMA 215

  Fly   196 PY-YEEANAKGARELETILKS 215
            |: |||.||..|..|..:.|:
  Fly   216 PFDYEELNANKANMLADMFKA 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 70/194 (36%)
Thioredoxin_like 4..77 CDD:294274 30/70 (43%)
GST_C_Delta_Epsilon 91..209 CDD:198287 39/123 (32%)
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 30/70 (43%)
GST_C_Delta_Epsilon 112..231 CDD:198287 39/124 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.