DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GstZ1

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_649894.1 Gene:GstZ1 / 41132 FlyBaseID:FBgn0037696 Length:246 Species:Drosophila melanogaster


Alignment Length:209 Identity:55/209 - (26%)
Similarity:101/209 - (48%) Gaps:24/209 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVN----ISGQEQLSEEYLKKNPEHTVPTLEDDGN 63
            |..||...||.....|::.||..::.|:....:    :|| ...::||.:.||...||:|:.||:
  Fly    33 KPILYSYWPSSCSWRVRVALAIKKIDYDIKPTSLLKTVSG-HAYTDEYREVNPMQKVPSLKIDGH 96

  Fly    64 YIWDSHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIP 128
            .:.||.|||.|| .:.....||.|:|.::||.:.:.:.     :..:||:.:..   .:.|:.|.
  Fly    97 TLCDSVAIIHYL-EETRPQPALLPQDPVKRAKIREIVE-----LICSGIQPLQN---VSVLDHIG 152

  Fly   129 KER-----YDAIVEIYDFVETFL---AGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRI 185
            |::     ...|...:..:|..|   || .:..||:|::||..|:..:.:...: :.|...||.|
  Fly   153 KDQSLQWAQHWISRGFQGLEKVLSHSAG-KFCVGDELSMADICLVPQVRNARRY-KADLTPYPTI 215

  Fly   186 IEWVRRLEKLPYYE 199
            :...:.|::|..::
  Fly   216 VRLNQELQELDVFK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 53/203 (26%)
Thioredoxin_like 4..77 CDD:294274 26/76 (34%)
GST_C_Delta_Epsilon 91..209 CDD:198287 24/117 (21%)
GstZ1NP_649894.1 GST_N_Zeta 34..109 CDD:239340 26/76 (34%)
maiA 35..240 CDD:273527 54/207 (26%)
GST_C_Zeta 122..236 CDD:198300 24/118 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460412
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.