DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and gstt1b

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:219 Identity:59/219 - (26%)
Similarity:100/219 - (45%) Gaps:46/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDSHAIIAYLV 76
            |.|.|:|.:......:.:::..:::....|..||:.|.||....||::|....:.:|.||:.||.
Zfish    11 SQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGKINPLRKFPTIKDGDFCLAESVAIMIYLA 75

  Fly    77 SKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGL------NRIPKERYDAI 135
            .|:...|..:|.||.:||.|::.|.::...:..:|.|.|    :|..|      ..:|||:.:..
Zfish    76 DKFHTPDHWFPADLQKRARVNEYLSWQHTSIRMHGAKII----WFKILIPEVLGAEVPKEKMENA 136

  Fly   136 -----VEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEI------------DRLKYP 183
                 |.:..|.:.||....:|.|||:::||         |||.|||            :|   |
Zfish   137 EENLNVALQLFQDKFLQDKPFIVGDQISLAD---------LVAIVEIMQPFAAGMDVFENR---P 189

  Fly   184 RIIEWVRRLE-----KLPYYEEAN 202
            ::..|..|:.     ||  ::||:
Zfish   190 KLKAWKDRVRVAIGAKL--FDEAH 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 56/211 (27%)
Thioredoxin_like 4..77 CDD:294274 18/64 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 36/140 (26%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 55/203 (27%)
GST_N_Theta 3..78 CDD:239348 18/66 (27%)
GST_C_Theta 91..217 CDD:198292 36/139 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10727
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.