DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GstO1

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:227 Identity:54/227 - (23%)
Similarity:86/227 - (37%) Gaps:58/227 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPE--------HTVPTLE- 59
            |.||.:...|....|.|.|.|.::||..:.:|           |:..||        ..||.|| 
  Fly    22 LKLYSMRFCPYAHRVHLVLDAKKIPYHAIYIN-----------LRDKPEWFSLVSSSTKVPALEL 75

  Fly    60 --DDGN-YIWDSHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFF 121
              :.|| .:.:|..|..||..||.:. .|||:|||::|  .:::..|....|.|.       .::
  Fly    76 VKEQGNPVLIESLIICDYLDEKYPEV-PLYPKDLLKKA--QEKILIERFGQFINA-------FYY 130

  Fly   122 NGLNRIPKERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVE---IDRLKYP 183
            ..|:..|::..|.               |:.||  |.:.:..|....|.......   :|.:.:|
  Fly   131 LLLHDNPEQLVDT---------------DHYAG--LVVYEEELKRRCTKFFGGDSPGMLDYMMWP 178

  Fly   184 RIIEWVRRLEKLPY-YEEANAKGARELETILK 214
                |..|.:.|.| :|:..........|::|
  Fly   179 ----WCERFDSLKYTFEQKFELSPERFPTLIK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 49/206 (24%)
Thioredoxin_like 4..77 CDD:294274 24/84 (29%)
GST_C_Delta_Epsilon 91..209 CDD:198287 21/121 (17%)
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 23/83 (28%)
GstA 22..216 CDD:223698 54/227 (24%)
GST_C_Omega 109..234 CDD:198293 23/128 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460193
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.