DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GstO2

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster


Alignment Length:186 Identity:43/186 - (23%)
Similarity:85/186 - (45%) Gaps:28/186 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDSHAII-AYLVSKYAD 81
            |:|.|||..:.:..:.|::.   :..|.|...:|...||.|:..|  :.|...:: :.::::|.|
  Fly    37 VRLMLAAKHIEHHKIYVDLI---EKPEWYKDFSPLGKVPALQLTG--VKDQPTLVESLIIAEYLD 96

  Fly    82 SD----ALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKE---RYDAIVEIY 139
            ..    .|:|.|.||:|:  .::..|.   ||..:.||...|..|  ...||:   .::..::::
  Fly    97 QQYPQTRLFPTDPLQKAL--DKILIER---FAPVVSAIYPVLTCN--PNAPKDAIPNFENALDVF 154

  Fly   140 DFVETFLAGHDYIAGDQLTIADFSL-------ISSITSLVAFVEIDRLKYPRIIEW 188
            : ||....|..|.||..:.|.|:.:       .|...:.....|:|..::.::::|
  Fly   155 E-VELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRFEKLLKW 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 43/186 (23%)
Thioredoxin_like 4..77 CDD:294274 14/59 (24%)
GST_C_Delta_Epsilon 91..209 CDD:198287 24/108 (22%)
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 15/63 (24%)
GstA 25..215 CDD:223698 43/186 (23%)
GST_C_Omega 110..235 CDD:198293 24/108 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460206
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.