DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Gr59f

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:114 Identity:21/114 - (18%)
Similarity:38/114 - (33%) Gaps:46/114 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 VETFLAG-------------HDYIAGDQLTIADFSLISSITSLVAFV------------------ 175
            ::.||.|             |.::....:...:..::.:|.|.::|.                  
  Fly   155 LQLFLVGIFACLAIFFNIWTHKFVVYRSILSINSYVMPNIISSISFAQYYLLLQGIAWRQRRLTE 219

  Fly   176 ----EIDRLKYPRIIEWVRRLEKLPYYEEANAKGARELETILKSTNFTF 220
                |:..|..|||.|    ::|:..: .||      |....|:.|.||
  Fly   220 GLERELTHLHSPRISE----VQKIRMH-HAN------LIDFTKAVNRTF 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 14/88 (16%)
Thioredoxin_like 4..77 CDD:294274
GST_C_Delta_Epsilon 91..209 CDD:198287 16/101 (16%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 21/114 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.