DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GstE4

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:222 Identity:128/222 - (57%)
Similarity:172/222 - (77%) Gaps:0/222 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYI 65
            |.|::|||::.|||.||..|||.||.||:|||.||:..:|..||::.||||:||||.|:||...|
  Fly     1 MGKISLYGLDASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDACI 65

  Fly    66 WDSHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVFANGIKAITKPLFFNGLNRIPKE 130
            ||||||:||||.|||.||.|||:||||||.|||.:|||:||:|.:.::.:|:|:.|.|...:|:.
  Fly    66 WDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLPRN 130

  Fly   131 RYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVRRLEKL 195
            :.|.|:::||||||||..||::|||||||||||::|:|||:..|:|:|..|||:|..|:.||::|
  Fly   131 QVDHILQVYDFVETFLDDHDFVAGDQLTIADFSIVSTITSIGVFLELDPAKYPKIAAWLERLKEL 195

  Fly   196 PYYEEANAKGARELETILKSTNFTFAT 222
            |||||||.|||.:...:|:|.|||..:
  Fly   196 PYYEEANGKGAAQFVELLRSKNFTIVS 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 110/191 (58%)
Thioredoxin_like 4..77 CDD:294274 44/72 (61%)
GST_C_Delta_Epsilon 91..209 CDD:198287 66/117 (56%)
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 44/72 (61%)
GstA 6..196 CDD:223698 110/189 (58%)
GST_C_Delta_Epsilon 91..209 CDD:198287 66/117 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467959
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 1 1.000 - - H120001
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118089at33392
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
1211.800

Return to query results.
Submit another query.