DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GstE14

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:222 Identity:68/222 - (30%)
Similarity:120/222 - (54%) Gaps:10/222 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTLYGVNPSPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWD 67
            |..||....|||||:..:.:..|.:..|...||:...||..:::|..||:|:||||......:.|
  Fly     5 KPILYYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTD 69

  Fly    68 SHAIIAYLVSKYADSDALYPRDLLQRAVVDQRLHFETGVVF---ANGIKAITKPLFFNGLNRIPK 129
            ||||:.:|..|:.:..:|:|::..:|..|...|.||...:|   ::.:.|..:..|.| ::....
  Fly    70 SHAILIHLAEKFDEGGSLWPQEHAERMKVLNLLLFECSFLFRRDSDFMSATVRQGFAN-VDVAHH 133

  Fly   130 ERYDAIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEIDRLKYPRIIEWVRRLEK 194
            ||  .:.|.|..:|.:|...|::||.|||:||.|::::::::.....:.  ::||:..|...:::
  Fly   134 ER--KLTEAYIIMERYLENSDFMAGPQLTLADLSIVTTLSTVNLMFPLS--QFPRLRRWFTAMQQ 194

  Fly   195 LPYYEEANAKGARELETILKST-NFTF 220
            |..| |||..|..:|...::|. :|.|
  Fly   195 LDAY-EANCSGLEKLRQTMESVGSFQF 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 57/194 (29%)
Thioredoxin_like 4..77 CDD:294274 27/72 (38%)
GST_C_Delta_Epsilon 91..209 CDD:198287 33/120 (28%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 59/199 (30%)
GST_N_Delta_Epsilon 6..79 CDD:239343 27/72 (38%)
GST_C_Delta_Epsilon 94..209 CDD:198287 33/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I4138
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I2398
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
98.970

Return to query results.
Submit another query.