DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GstT1

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster


Alignment Length:227 Identity:64/227 - (28%)
Similarity:111/227 - (48%) Gaps:32/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SPPVRAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKKNPEHTVPTLEDDGNYIWDSHAIIAYLV 76
            |.|.||:.:.:...:.|:|...|.:..||||::||...|....||.:.|....:.:|.:|:.||.
  Fly    13 SQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGESVSIVRYLA 77

  Fly    77 SKYADSDALYPRDLLQRAVVDQRL---HFETGVVFANGIKAITKPLFF--------NGLNRIPKE 130
            .|...|:.|||:.|.:||.||:.|   ||...:|.:         |||        .||...||.
  Fly    78 DKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCS---------LFFRQVWLLPAKGLAPAPKP 133

  Fly   131 RYDAIVEIYDFVETFLA-------GHDYIAGDQLTIADFSLISSITSL-VAFVEIDRLKYPRIIE 187
              :::.::...||:.|.       ..|::.||:||:||....|.|..: :....::..::|::.:
  Fly   134 --ESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPKVAK 196

  Fly   188 WVRRLEKL--PYYEEANAKGARELETILKSTN 217
            |:.|:...  |||:||::...:..:..:|:.|
  Fly   197 WMERVRDATNPYYDEAHSFVYKTSQQAVKAKN 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 57/204 (28%)
Thioredoxin_like 4..77 CDD:294274 21/64 (33%)
GST_C_Delta_Epsilon 91..209 CDD:198287 35/138 (25%)
GstT1NP_610509.2 GstA 5..204 CDD:223698 57/201 (28%)
GST_N_Theta 5..80 CDD:239348 21/66 (32%)
GST_C_Theta 93..218 CDD:198292 35/135 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460105
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.