DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and Clic

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001259537.2 Gene:Clic / 32349 FlyBaseID:FBgn0030529 Length:260 Species:Drosophila melanogaster


Alignment Length:126 Identity:24/126 - (19%)
Similarity:49/126 - (38%) Gaps:34/126 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LQRAVVDQRLHFETGVVFANGIKAITKP--LFFNGLNRIPKERYDAIVEIYDFVETFLAGHDYIA 153
            :|:...|.|.:||.           |.|  |..|||..:..|:.:..:     ::....|::   
  Fly    68 MQKPPPDFRTNFEA-----------THPPILIDNGLAILENEKIERHI-----MKNIPGGYN--- 113

  Fly   154 GDQLTIADFSLISSITSL-----VAFVEIDRLKYPRIIEWVRRLEKLPYYEEANAKGAREL 209
               |.:.|..:.:.|.:|     :..|:.|..|...::..:|::.     :..:|:..|.|
  Fly   114 ---LFVQDKEVATLIENLYVKLKLMLVKKDEAKNNALLSHLRKIN-----DHLSARNTRFL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 21/111 (19%)
Thioredoxin_like 4..77 CDD:294274
GST_C_Delta_Epsilon 91..209 CDD:198287 23/124 (19%)
ClicNP_001259537.2 GST_N_CLIC 18..112 CDD:239359 12/59 (20%)
O-ClC 21..231 CDD:129941 24/126 (19%)
GST_C_CLIC 118..232 CDD:198307 10/54 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460391
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.