DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstE5 and GstT4

DIOPT Version :9

Sequence 1:NP_611327.1 Gene:GstE5 / 37110 FlyBaseID:FBgn0063495 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_572886.2 Gene:GstT4 / 32299 FlyBaseID:FBgn0030484 Length:237 Species:Drosophila melanogaster


Alignment Length:222 Identity:57/222 - (25%)
Similarity:95/222 - (42%) Gaps:46/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RAVKLTLAALQLPYEFVNVNISGQEQLSEEYLKK-NPEHTVPTLEDDGNYIWDSHAIIAYLVSKY 79
            ||:.:.|.|.::|:|.:.:::...|.|:.|:... |....:|.:.|.|..:.::.||..:|..:.
  Fly    17 RALYILLEASKIPFEAIPISMLKGEHLTGEFRDNVNRFRKLPAITDHGYQLSENVAIFRHLAREK 81

  Fly    80 ADSDALYPRDLLQRAVVDQRLHFE---TGVVFANGIK--------AITKPLFFNGLNRIPKERYD 133
            ...:..|||..|.|:.:|:.|.::   .||......:        ..|:|. .|.:|...|:...
  Fly    82 LVPEHWYPRRHLGRSRIDEYLAWQQTNMGVATTEYFQQKWLVPYLQKTRPA-DNAVNLASKQLEH 145

  Fly   134 AIVEIYDFVETFLAGHDYIAGDQLTIADFSLISSITSLVAFVEID------------RLKYPRII 186
            .:.|   |.:.||....::.||.::.||.|         |..|||            |.|..|..
  Fly   146 TLNE---FEQLFLNSRKFMMGDNISYADLS---------AICEIDQPKSIGYNAFQNRNKLARWY 198

  Fly   187 EWVRRLEKL-PYYE------EANAKGA 206
            |.||  |:| |:|:      ||..||:
  Fly   199 ETVR--EELGPHYKEVLGEFEAKLKGS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstE5NP_611327.1 GstA 4..196 CDD:223698 51/204 (25%)
Thioredoxin_like 4..77 CDD:294274 16/61 (26%)
GST_C_Delta_Epsilon 91..209 CDD:198287 38/146 (26%)
GstT4NP_572886.2 GST_N_Theta 5..80 CDD:239348 16/62 (26%)
GST_C_Theta 95..220 CDD:198292 35/139 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459988
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.